This is a working overview of Mod GRF(1-29), written for readers who want more than a one-paragraph summary but less than a textbook.
This page was last updated on 2025-09-25 and is reviewed periodically as new material appears.
Analytical confirmation usually relies on reversed-phase high-performance liquid chromatography for purity and on liquid chromatography coupled to mass spectrometry for identity. Mass data reveal the expected molecular mass and can flag truncated or oxidized species. Amino acid analysis and peptide mapping provide sequence-level verification. Immunoassays are used in some biological matrices, but antibodies raised against one releasing-hormone analog may cross-react with another. Reported purity figures depend heavily on the method used, so comparisons between suppliers require matching the analytical approach.
The two variants differ dramatically in how long they persist in circulation. The form lacking the albumin-binding group has a plasma half-life measured in tens of minutes, comparable to the natural hormone fragment. The version carrying the drug affinity complex binds albumin and shows a half-life of roughly six to eight days in human studies. That figure comes from small trials that tracked hormone levels over extended periods. The physiological consequences of sustained versus pulsatile stimulation are still debated and the literature does not settle the point.
Pharmacokinetic behaviour differs sharply between the two forms. The DAC-bearing peptide shows an extended circulation time measured in days, whereas the version without the complex is cleared within roughly half an hour. This gap shapes how researchers design dosing schedules in animal models. Whether the prolonged presence of the DAC form produces effects meaningfully different from the short-acting variant remains an open question, since comparative human data are scarce.
CJC-1295 is a synthetic peptide designed to mimic growth hormone-releasing hormone (GHRH), the endogenous signal that prompts the pituitary gland to release growth hormone. The compound is a modified fragment of the natural hormone, spanning the first twenty-nine amino acids of GHRH with several substitutions that slow enzymatic breakdown. Two variants circulate in research settings: one carrying a drug affinity complex (DAC) and one without it. The DAC-free form is frequently labelled Mod GRF(1-29) in catalogs and discussion forums.
| Property | Value | Notes |
|---|---|---|
| Molecular mass | Approximately 3.4 to 3.6 kDa | Depends on whether the affinity complex is attached |
| Appearance | White to off-white lyophilized powder | Freeze-dried solid, often in a sealed vial |
| Solubility | Soluble in water and aqueous buffers | Dissolution rate varies with pH and buffer salt |
| Typical storage | Below minus 20 degrees Celsius, dry and dark | Dissolved material is usually kept cold and used promptly |
| Common analytical methods | Reversed-phase HPLC and mass spectrometry | Peptide mapping and amino acid analysis add sequence detail |
The core sequence keeps the receptor-binding region of GHRH while replacing four positions that are vulnerable to dipeptidyl peptidase-4 and other proteases. Substitutions at positions 2, 8, 15, and 27 raise metabolic stability relative to the natural hormone. The N-terminal residues remain essential for activity, so changes there generally lower potency. Molecular weight sits near 3368 daltons for the tetrasubstituted analog without the linker, while the albumin-binding form is heavier because of the added maleimide group.
CJC-1295 is a synthetic peptide modeled on growth hormone-releasing hormone, the hypothalamic signal that prompts the pituitary to release growth hormone. Its sequence corresponds to the first twenty-nine residues of human GHRH, with four substitutions that slow enzymatic breakdown. Early descriptions placed the compound in research on growth hormone deficiency and related conditions, and later literature groups it with the long-acting GHRH analogs. The name appears in both laboratory and popular fitness writing, where it sometimes labels chemically different peptides.
Two related peptides circulate under the CJC-1295 label, and they differ mainly in how long they persist in circulation. The version carrying a drug affinity complex includes a maleimidopropionic acid linker that forms a covalent bond with serum albumin. The other version, usually written as modified GRF(1-29) or tetrasubstituted GRF(1-29), lacks that linker and is cleared quickly. Mixing the two produces inconsistent readings of published half-life values, because the linker rather than the receptor-facing sequence drives most of the difference.
Two forms circulate in research settings and are frequently confused. One carries the drug affinity complex and is often written as CJC-1295 with DAC; the other lacks that group and is usually called modified GRF(1-29). The two share the same core sequence but differ sharply in how long they persist in blood. Products labelled only as CJC-1295 normally refer to the version carrying the complex. Documentation that omits the distinction leaves the intended molecule ambiguous.
CJC-1295 is a synthetic peptide built as a long-acting analogue of growth hormone-releasing hormone. Its backbone matches the first twenty-nine residues of the natural human hormone, with four amino acid substitutions added to slow enzymatic breakdown. A reactive maleimide group, commonly termed the drug affinity complex, allows the peptide to attach to circulating albumin after administration. That albumin attachment keeps the molecule in the bloodstream for an extended period instead of being cleared within minutes.
The compound emerged from work at a Canadian biotechnology firm in the early 2000s. Early human studies examined its effect on growth hormone and insulin-like growth factor 1 in healthy volunteers and in people with HIV-associated fat redistribution. Reports described sustained increases in both markers after a single injection. Development did not advance to regulatory approval, and the clinical programme was later discontinued. The molecule is now encountered mainly as a research chemical rather than a marketed medicine.
Reverse-phase high-performance liquid chromatography is the standard tool for purity assessment. The technique separates the target peptide from truncated or modified byproducts. Mass spectrometry confirms molecular weight and supports sequence verification. Electrospray ionization and matrix-assisted laser desorption are both used. Amino acid analysis provides an independent check on composition. Purity values are commonly reported as area percentage from the chromatogram. Residual trifluoroacetate and water content are also measured in many quality programs.
Batch-to-batch consistency depends on solid-phase peptide synthesis and subsequent purification. Coupling efficiency, resin choice, and cleavage conditions all affect the final profile. Counter-ion content and moisture can shift the apparent mass of a batch. Documentation typically includes a certificate of analysis with chromatograms and spectra. Independent verification by a second laboratory is sometimes requested. Whether a given certificate reflects the actual vial contents depends on chain of custody. Analytical methods themselves carry uncertainty that should be stated alongside results.
Lyophilized material is typically stored at minus twenty degrees Celsius or lower. Keeping the vial dry and protected from light preserves peptide integrity. Repeated freeze-thaw cycles can cause aggregation or loss of activity. Once dissolved, solutions are generally kept at two to eight degrees Celsius. Stability data for reconstituted solutions vary, and long-term behavior is not fully established. Working aliquots reduce the number of times a stock container is opened.
One product of fatty acid metabolism are the prostaglandins, compounds having diverse hormone-like effects in animals. Prostaglandins have been found in almost every tissue in humans and other animals. They are enzymatically derived from arachidonic acid, a 20-carbon polyunsaturated fatty acid. Every prostaglandin therefore contains 20 carbon atoms, including a 5-carbon ring. They are a subclass of eicosanoids and form the prostanoid class of fatty acid derivatives. The prostaglandins are synthesized in the cell membrane by the cleavage of arachidonate from the phospholipids that make up the membrane. This is catalyzed either by phospholipase A2 acting directly on a membrane phospholipid, or by a lipase acting on DAG (diacyl-glycerol). The arachidonate is then acted upon by the cyclooxygenase component of prostaglandin synthase. This forms a cyclopentane ring roughly in the middle of the fatty acid chain. The reaction also adds 4 oxygen atoms derived from two molecules of O2. The resulting molecule is prostaglandin G2, which is converted by the hydroperoxidase component of the enzyme complex into prostaglandin H2. This highly unstable compound is rapidly transformed into other prostaglandins, prostacyclin and thromboxanes. These are then released into the interstitial fluids surrounding the cells that have manufactured the eicosanoid hormone. If arachidonate is acted upon by a lipoxygenase instead of cyclooxygenase, hydroxyeicosatetraenoic acids and leukotrienes are formed. They also act as local hormones.
Some analysts were attracted to the hypothesis that the uprising had been instigated or even planned by the African National Congress (ANC), an organisation which had played an important role in opposing apartheid before 1960, when it was banned by the government and went into exile in Lusaka, Zambia. Harvard Law School's Stephen M. Davis provided the paradigmatic statement of this hypothesis in Apartheid's Rebels, which argued that the unrest was the result of "a massive transformation of the black public" wrought by the ANC by means of "a widening clandestine network of cells to politicize blacks and school them in confrontation". Anthea Jefferey of the South African Institute of Race Relations made a similar argument, in terms less complimentary to the ANC, in her People's War.
== Inhibitors == Many inhibitors of OGT enzymatic activity have been reported. OGT inhibition results in global downregulation of O-GlcNAc. Cells appear to upregulate OGT and downregulate OGA in response to OGT inhibition.
Blood PFAS levels have been shown to decline when direct contact ceases. PFOA and PFOS levels have declined in U.S. and European fluorochemical workers due to improved facilities, increased usage of personal protective equipment, and the discontinuation of these chemicals from production. Occupational exposure to PFAS in manufacturing continues to be an active area of study in China with numerous investigations linking worker exposure to various PFAS.
Ribosomes are essential for protein synthesis in all living organisms. Prokaryotic and eukaryotic ribosomes both contain a scaffold of ribosomal RNA (rRNA) on which are arrayed an extensive variety of ribosomal proteins (RP). Ribosomopathies can arise from abnormalities of either rRNA or the various RPs. The nomenclature of rRNA subunits is derived from each component's Svedberg unit, which is an ultracentrifuge sedimentation coefficient, that is affected by mass and also shape. These S units of the rRNA subunits cannot simply be added because they represent measures of sedimentation rate rather than of mass. Eukaryotic ribosomes are somewhat larger and more complex than prokaryotic ribosomes. The overall 80S eukaryotic rRNA structure is composed of a large 60S subunit (LSU) and a small 40S subunit (SSU). In humans, a single transcription unit separated by 2 internally transcribed spacers encodes a precursor, 45S. The precursor 45S rDNA is organized into 5 clusters (each has 30-40 repeats) on chromosomes 13, 14, 15, 21, and 22. These are transcribed in the nucleolus by RNA polymerase I. 45S is processed in the nucleus via 32S rRNA to 28S and 5.8S, and via 30S to 18S, as shown in the diagram. 18S is a component of the ribosomal 40S subunit. 28S, 5.8S and 5S, which is transcribed independently, are components of 60S. The 5S DNA occurs in tandem arrays (~200-300 true 5S genes and many dispersed pseudogenes); the largest is on chromosome 1q41-42. 5S rRNA is transcribed by RNA polymerase III.
Sources: en.wikipedia.org
Foliate papillae (from Latin foliātus 'leafy') are short vertical folds and are present on each side of the tongue. They are located on the sides at the back of the tongue, just in front of the palatoglossal arch of the fauces. There are four or five vertical folds, and their size and shape is variable. The foliate papillae appear as a series of red colored, leaf–like ridges of mucosa. They are covered with epithelium, lack keratin and so are softer, and bear many taste buds. They are usually bilaterally symmetrical. Sometimes they appear small and inconspicuous, and at other times they are prominent. Because their location is a high risk site for oral cancer, and their tendency to occasionally swell, they may be mistaken as tumors or inflammatory disease. Taste buds, the receptors of the gustatory sense, are scattered over the mucous membrane of their surface. Serous glands drain into the folds and clean the taste buds. Lingual tonsils are found immediately behind the foliate papillae and, when hyperplastic, cause a prominence of the papillae.
In the brain, the canonical mechanism of CB1 receptor activation is a form of short-term synaptic plasticity initiated via retrograde signaling of endogenous CB1 agonists such as 2AG or AEA (two primary endocannabinoids). This mechanism of action is called depolarization-induced suppression of inhibition (DSI) or depolarization-induced suppression of excitation (DSE), depending on the classification of the presynaptic neuron acted upon by the retrograde messenger (see diagram at left). In the case of CB1R agonism on the presynaptic membrane of a GABAergic interneuron, activation leads to a net effect of increased activity, while the same activity on a glutamatergic neuron leads to the opposite net effect. The release of other neurotransmitters is also modulated in this way, particularly dopamine, dynorphin, oxytocin, and vasopressin.
Another benefit with surgical intervention is visualization and evacuation of any condral fragments or loose bodies that may increase arthritis risk, lead to decreased range of motion of the joint as well as pain. In some instances, primarily seen with femoral head fractures on the weight bearing surface of the bone, joint replacement is indicated. The femoral head is known for leading to avascular necrosis and ORIF is not sufficient to maintain the blood supply to the fractured fragment. Therefore, replacement of the femoral head with a hemiarthroplasty or total hip arthroplasty is indicated in this case.
=== RISC activation and catalysis === Exogenous dsRNA is detected and bound by an effector protein, known as RDE-4 in C. elegans and R2D2 in Drosophila, that stimulates Dicer activity. This protein only binds long dsRNAs, but the mechanism producing this length specificity is unknown. This RNA-binding protein then facilitates the transfer of cleaved siRNAs to the RISC complex. In C. elegans this initiation response is amplified through the synthesis of a population of 'secondary' siRNAs during which the Dicer-produced initiating or 'primary' siRNAs are used as templates. These 'secondary' siRNAs are structurally distinct from Dicer-produced siRNAs and appear to be produced by an RNA-dependent RNA polymerase (RdRP).
==== Males ==== In the past, early onset of puberty in males has been associated with positive outcomes, such as leadership in high school and success in adulthood. However, recent studies have revealed that the risks and problems of early maturation in males might outweigh the benefits. Early-maturing males develop "more aggressive, law-breaking, and alcohol abusing" behaviors, which result in anger towards parents and trouble in school and with the police. Early puberty also correlates with increased sexual activity and a higher instance of teenage pregnancy, both of which can lead to depression and other psychosocial issues. On the other hand, late-maturing males develop lower self-esteem and confidence and generally have lower popularity among peers, due to their less-developed physiques. Also, they experience problems with anxiety and depression and are more likely to be afraid of sex than other males.
Sources: en.wikipedia.org
The Roman author Vitruvius reported the health dangers of lead and modern writers have suggested that lead poisoning played a major role in the decline of the Roman Empire. Other researchers have criticized such claims, pointing out, for instance, that not all abdominal pain is caused by lead poisoning. According to archaeological research, Roman lead pipes increased lead levels in tap water but such an effect was "unlikely to have been truly harmful". When lead poisoning did occur, victims were called "saturnine", dark and cynical, after the ghoulish father of the gods, Saturn. By association, lead was considered the father of all metals. Its status in Roman society was low as it was readily available and cheap.
== Career == After gaining her doctorate, Ala-Kokko moved to Thomas Jefferson University in Philadelphia, United States, to carry out postdoctoral research in the group of Darwin Prockop. While there, Ala-Kokko focused her attention more directly on describing the structure, function and possible errors in genes that code for collagen proteins. She worked at Thomas Jefferson University as a research associate from 1987 to 1989, and as an instructor from 1989 to 1991. In 1990, Ala-Kokko was granted title of docent by the University of Oulu in the field of medical biochemistry. Her research work continued to be based in Philadelphia until 1997, when she was selected as a senior research fellow by the Academy of Finland. In the same year, Ala-Kokko also started at MCP Hahnemann University as an adjunct associate professor. In 2000, Ala-Kokko started work at the gene therapy centre of Tulane University in New Orleans. She worked there as an associate professor, and later became a full professor with tenure. In 2003 she was named professor of medical biochemistry and molecular biology at the University of Oulu. She left Tulane University in 2004. The company Connective Tissue Gene Tests was founded by Ala-Kokko in 2004 with her husband James Hyland. They offer over a thousand tests which function as molecular diagnostic tests of connective tissue disorders. As of 2018 her responsibility in the company is for research, development and technology. She is also responsible for overseeing all the tests that the company produces.
== Chemistry == Grammotoxin is a 36 amino acid protein toxin, with the sequence Asp-Cys-Val-Arg-Phe-Trp-Gly-Lys-Cys-Ser-Gln-Thr-Ser-Asp-Cys-Cys-Pro-His-Leu-Ala-Cys-Lys-Ser-Lys-Trp-Pro-Arg-Asn-Ile-Cys-Val-Trp-Asp-Gly-Ser-Val (DCVRFWGKCSQTSDCCPHLACKSKWPRNICVWDGSV), and disulfide bridges between Cys2-Cys16, Cys9-Cys21 and Cys15-Cys30. It forms an inhibitor cystine knot motif, common in spider toxins. Its chemical formula is: C177H268N52O50S6 Grammotoxin can be purified from Grammostola spatulata venom by reverse phase high performance liquid chromatography.
H2A (aq) + H2O (l) ⇌ H3O+ (aq) + HA− (aq) Ka1 HA− (aq) + H2O (l) ⇌ H3O+ (aq) + A2− (aq) Ka2 The first dissociation constant is typically greater than the second (i.e., Ka1 > Ka2). For example, sulfuric acid (H2SO4) can donate one proton to form the bisulfate anion (HSO−4), for which Ka1 is very large; then it can donate a second proton to form the sulfate anion (SO2−4), wherein the Ka2 is intermediate strength. The large Ka1 for the first dissociation makes sulfuric a strong acid. In a similar manner, the weak unstable carbonic acid (H2CO3) can lose one proton to form bicarbonate anion (HCO−3) and lose a second to form carbonate anion (CO2−3). Both Ka values are small, but Ka1 > Ka2 . A triprotic acid (H3A) can undergo one, two, or three dissociations and has three dissociation constants, where Ka1 > Ka2 > Ka3.
==== Council house sales ==== Heseltine was a convert to the sale of council houses, a policy pioneered by some Conservative local authorities, e.g. Birmingham. He also favoured the policy of giving away houses, a policy first mooted from the backbenches by Peter Walker in the mid-1970s, not least as some local authorities were spending more on maintenance than they were recouping in rents. Thatcher, who was concerned at the reaction from those who had made financial sacrifices to buy their homes, was initially sceptical. After taking office Heseltine issued a circular enabling councils, if they chose, to sell houses at 30% discount and to offer 100% mortgages. The Housing Act 1980 enacting Right to Buy was delayed by a Lords amendment and did not reach the statute book until the end of 1980. Some councils were slow in processing applications (one even threatened to house "problem" families next door to those who bought) and Heseltine made an example of Norwich by setting up a DOE sales office there; Norwich council took him to court and lost. At the time Heseltine permitted councils to use up to 75% of sales receipts for renovating the housing stock, and was angry in later years when this was cut back by the Treasury. Heseltine also insisted on the doubling of rents to encourage buying. During the 1980s over a million council houses, around 20% of the stock, were sold, and by 1987 Labour had dropped their opposition to the Right to Buy.
Sources: en.wikipedia.org
The version carrying the affinity complex bears a maleimide group that binds serum albumin, which extends its circulation time to several days. The version without it lacks this group and clears within roughly half an hour. The two are chemically related but behave very differently once in the body.
In common usage the name without the affinity complex is often equated with MOD GRF 1-29, a fragment carrying four stabilizing substitutions. Strictly speaking, the term originally referred to the albumin-binding version. The overlap in naming causes frequent ambiguity in both informal and technical writing.
Reversed-phase chromatography separates the peptide from related impurities and yields a purity estimate. Mass spectrometry confirms the molecular mass and detects modifications such as oxidation. Sequence-level checks rely on peptide mapping or amino acid analysis when stronger confirmation is needed.
The synthetic peptide keeps the receptor-binding region of GHRH but carries substitutions that resist enzymatic cleavage. In the DAC version, an added group also anchors the molecule to albumin, extending its presence in the bloodstream.