CJC-1295 raises a handful of sensible questions. This page answers them in order, starting with the fundamentals and moving to applications.
Reviewed 2025-12-12. Anything still debated is marked as such rather than presented as settled.
Purity is most often assessed by reversed-phase high-performance liquid chromatography, reported as a percentage of total peak area. Identity is confirmed by mass spectrometry, which yields a molecular ion consistent with the expected sequence. Amino acid analysis and peptide mapping provide additional characterization. Reported purity values are method-dependent, so figures from different laboratories are not always directly comparable without details of column, gradient, and detection wavelength.
Peptide degradation proceeds mainly through hydrolysis, oxidation of methionine, and deamidation of asparagine or glutamine residues. The maleimide group on the albumin-binding variant can also react with thiols or hydrolyze in aqueous media. Because these pathways accelerate with temperature and pH extremes, handling conditions strongly influence measured stability. Stability data in the public literature are limited and often generated under differing conditions, so general statements about shelf life should be read as approximate.
Identity and purity are established with reversed phase high performance liquid chromatography coupled to mass spectrometry. The chromatographic step separates the target peptide from truncated sequences and deletion products, while the mass measurement confirms the expected molecular weight to within a fraction of a dalton. Because the two common variants differ by the presence of the linker, mass alone can distinguish them in the unconjugated state. Amino acid analysis and peptide mapping are used when sequence level confirmation is required.
Lyophilized material is generally stable for extended periods when held at minus twenty degrees Celsius or below and protected from moisture and light. In solution the peptide is more labile; bond hydrolysis, aggregation and oxidation of susceptible residues all proceed faster at ambient temperature. Repeated freeze and thaw cycles should be avoided because they promote clumping and loss of soluble material. The conjugated variant adds a further consideration, since the maleimide group can hydrolyze in aqueous buffer and lose its ability to react with albumin.
| Property | Value | Notes |
|---|---|---|
| Appearance | White to off-white lyophilized powder | Visual descriptor; not a measure of purity |
| Solubility class | Freely soluble in water | Aqueous dissolution may require gentle mixing |
| Typical storage (powder) | −20 °C or below, desiccated | Protect from light and ambient moisture |
| Typical storage (solution) | 2–8 °C, short term | Freeze aliquots where longer holding is needed |
| Purity assessment | Reversed-phase HPLC, area percent | Values depend on column, gradient, and detection wavelength |
The dividing feature between the two forms is a maleimide-based drug affinity complex, abbreviated DAC. In the DAC-bearing version, a linker attaches the peptide to serum albumin after administration, and that association slows removal from plasma. The version lacking DAC appears in catalogs as MOD GRF(1-29) or tetrasubstituted GRF(1-29). Because informal writing treats both as one item, comparisons drawn from such sources routinely blend measurements taken from two molecules with substantially different behavior.
Four amino acid substitutions separate the modified backbone from the parent GRF(1-29) sequence. These changes reduce recognition by dipeptidyl peptidase IV and related proteases, extending the interval before degradation. Development work in this area sought longer-acting GHRH analogs for endocrine investigation. Published descriptions treat the substitution set as a defining property of the core sequence, while the albumin-binding linker is described separately as an optional addition to that same backbone.
Verification matters because research peptides vary widely in quality. A certificate of analysis is only as reliable as the method behind it, and a single chromatographic trace reveals little about counter-ions, residual solvents, or water content. Independent laboratories commonly pair mass confirmation with chromatographic purity and, where relevant, quantify water along with acetate or trifluoroacetate content. Reported purity figures are not standardized across suppliers, so a stated value such as ninety-eight percent is not directly comparable unless the analytical method, column, and detection wavelength accompany it.
Characterization of this peptide relies on a small set of routine techniques. Reversed-phase high-performance liquid chromatography separates the target from truncated or oxidized by-products and yields a purity estimate when paired with ultraviolet detection near 214 nanometers. Mass spectrometry, either electrospray coupled to liquid chromatography or matrix-assisted laser desorption, confirms that the observed mass matches the value calculated for the expected sequence. Amino acid analysis, and enzymatic digestion followed by fragment mapping, are used when the sequence itself rather than the mass requires verification.
Stability depends heavily on physical state. A lyophilized powder kept dry, desiccated, and shielded from light typically holds its integrity for months to years at minus twenty degrees Celsius, and longer at minus eighty. Once dissolved, the peptide becomes far more vulnerable, since peptide bond hydrolysis, oxidation of susceptible residues, and aggregation all proceed faster in solution. Buffers near neutral pH are generally gentler than strongly acidic or alkaline conditions. Repeated freeze-thaw cycles and exposure to air-liquid interfaces during vigorous mixing cause losses that are easy to overlook.
This is a nice example as affinity purification is used to purify the initial GST-fusion protein, to remove the undesirable anti-GST antibodies from the serum and to purify the target antibody. Monoclonal antibodies can also be selected to bind proteins with great specificity, where protein is released under fairly gentle conditions. This can become of use for further research in the future. A simplified strategy is often employed to purify antibodies generated against peptide antigens. When the peptide antigens are produced synthetically, a terminal cysteine residue is added at either the N- or C-terminus of the peptide. This cysteine residue contains a sulfhydryl functional group which allows the peptide to be easily conjugated to a carrier protein (e.g. Keyhole limpet hemocyanin (KLH)). The same cysteine-containing peptide is also immobilized onto an agarose resin through the cysteine residue and is then used to purify the antibody. Most monoclonal antibodies have been purified using affinity chromatography based on immunoglobulin-specific Protein A or Protein G, derived from bacteria. Immunoaffinity chromatography with monoclonal antibodies immobilized on monolithic column has been successfully used to capture extracellular vesicles (e.g., exosomes and exomeres) from human blood plasma by targeting tetraspanins and integrins found on the surface of the EVs. Immunoaffinity chromatography is also the basis for immunochromatographic test (ICT) strips, which provide a rapid means of diagnosis in patient care.
The structure of TEV protease has been solved by X-ray crystallography. It is composed of two β-barrels and a flexible C-terminal tail and displays structural homology to the chymotrypsin superfamily of proteases (PA clan, C4 family by MEROPS classification). Although homologous to cellular serine proteases (such as trypsin, elastase, thrombin etc.), TEV protease uses a cysteine as its catalytic nucleophile (as do many other viral proteases). Covalent catalysis is performed with an Asp-His-Cys triad, split between the two barrels (Asp on β1 and His and Cys on β2). The substrate is held as a β-sheet, forming an antiparallel interaction with the cleft between the barrels and a parallel interaction with the C-terminal tail. The enzyme therefore forms a binding tunnel around the substrate and side chain interactions control specificity.
Between 1930 and 1960, the Soviet Union created a system of, according to Anne Applebaum and the "perspective of the Kremlin", slave labor camps called the Gulag (Russian: ГУЛаг, romanized: GULag). Prisoners in these camps were worked to death by a combination of extreme production quotas, physical and psychological brutality, hunger, lack of medical care, and the harsh environment. Aleksandr Solzhenitsyn, who survived eight years of Gulag incarceration, provided firsthand testimony about the camps with the publication of The Gulag Archipelago, after which he was awarded the Nobel Prize in Literature. Fatality rate was as high as 80% during the first months in many camps. Hundreds of thousands of people, possibly millions, died as a direct result of forced labour under the Soviets. Golfo Alexopoulos suggests comparing labor in the Gulag with "other forms of slave labor" and notes its "violence of human exploitation" in Illness and Inhumanity in Stalin's Gulag:
Sources: en.wikipedia.org
Vasopressin is released into the brain in a circadian rhythm by neurons of the suprachiasmatic nucleus. Vasopressin released from posterior pituitary is associated with nausea. Recent evidence suggests that vasopressin may have analgesic effects. The analgesia effects of vasopressin were found to be dependent on both stress and sex.
== Research == While it is unclear whether PF-00446687 itself will be potent and effective enough to be developed for medical use, it has demonstrated that selectively targeting the MC4 subtype can produce similar aphrodisiac effects to older non-selective peptide-based melanocortin receptor agonists like melanotan II and bremelanotide, without the side effects caused by action at the other melanocortin receptor subtypes.
=== Czech === Traditionally, the word nejneobhospodařovávatelnějšími ("of the least cultivable", 28 letters) is considered as the longest Czech word, but there are some longer artificial words. Most of them are compound adjectives in dative, instrumental or other grammatical case and derived from the iterative or frequentative verbal form or the ability adjective form (like "-able").
In molecular biology, alanine scanning is a site-directed mutagenesis technique used to determine the contribution of a specific residue to the stability or function of a given protein. Alanine is used because of its non-bulky, chemically inert, methyl functional group that nevertheless mimics the secondary structure preferences that many of the other amino acids possess. Sometimes bulky amino acids such as valine or leucine are used in cases where conservation of the size of mutated residues is needed. This technique can also be used to determine whether the side chain of a specific residue plays a significant role in bioactivity. This is usually accomplished by site-directed mutagenesis or randomly by creating a PCR library. Furthermore, computational methods to estimate thermodynamic parameters based on simulated alanine substitutions have been developed. This technique is rapid, because many side chains are analyzed simultaneously and the need for protein purification and biophysical analysis is circumvented. The technology is very mature at this point and is widely used in biochemical fields. The data can be tested by IR, NMR Spectroscopy, mathematical methods, bioassays, etc. One good example of alanine scanning is the examination of the role of charged residues on the surface of proteins. In a systematic study on the roles of conserved charged residues on the surface of epithelial sodium channel (ENaC), alanine scanning was used to reveal the importance of charged residues for the process of transport of the proteins to the cell surface.
Sources: en.wikipedia.org
In February 2018, the Wall Street Journal listed Medtronic's 2015 tax inversion to Ireland as the largest U.S. corporate tax inversion executed between 2013 and 2016. In May 2018, Medtronic was ranked as the largest corporate tax inversion in history. In May 2018, Medtronic was ranked as the world's largest medical device company by 2017 revenues (see table below). In May 2019, Medtronic announced it would acquire Titan Spine, a technology company focusing on titanium spine implants. Chief Executive Officer Omar Ishrak retired in April 2020 and stayed on as executive chairman and chairman of the board until December 2020. Ishrak was succeeded by senior executive Geoff Martha. In January 2020, the company announced its intention to acquire Stimgenics, LLC and its primary therapy: differential target, multiplexed, spinal cord stimulation. In July, the company announced it would acquire Medicrea for €7.00 per share. In August, Medtronic announced it would acquire Companion Medical, who manufacture a smart insulin pen system, which connects to a diabetes management app. In September Medtronic acquired Avenu Medical for an undisclosed sum. In February 2021, the company recalled its HeartWare Ventricular Assist Device. In June 2021, the controller ports were pulled from the market. On 3 June 2021, the FDA alerted physicians to stop new implants of the HVAD system due to "an increased risk of neurological adverse events and mortality associated with the internal pump." In November 2021, the company was added to the Dow Jones Sustainability World Index.
A genetic admixture study by Kshatriya (1995) found the Sinhalese to have a higher contribution from Indian Tamils (69.86% +/- 0.61), compared with the Bengalis (25.41% +/- 0.51). Genetic distance analysis by Roychoudhury AK et al. (1985) suggested the Sinhalese are more closely related to South and West Indian populations, than the Bengalis. Genetic distance analysis by Kirk (1976) suggested the Sinhalese are closer to the Tamils and Keralites of South India, than they are to the populations in Gujarat or the Panjab.
Lepirudin is an anticoagulant that functions as a direct thrombin inhibitor. Brand name: Refludan, Generic: Lepirudin rDNA for injection. Lepirudin is a recombinant hirudin derived from yeast cells. Lepirudin is almost identical to hirudin extracted from Hirudo medicinalis, having the amino acid sequence LTYTDCTESGQNLCLCEGSNVCGQGNKCILGSDGEKNQCVTGEGTPKPQSHNDGDFEEIPEEYLQ with disulfide bridges at Cys6-Cys14, Cys16-Cys28 and Cys22-Cys39, and differs from by the substitution of leucine for isoleucine at the N-terminal end of the molecule and the absence of a sulfate group on the tyrosine at position 63. Lepirudin may be used as an anticoagulant when heparins (unfractionated or low-molecular-weight) are contraindicated because of heparin-induced thrombocytopenia.
The album was originally scheduled for worldwide release in 2017, but was postponed in lieu of Live in Chicago; however, it was only released in Japan in September 2017, with a bonus disc with recordings from the band's tour there in December 2015. The worldwide release added a performance of "Fracture", plus three pieces drawn from the nightly Fripp-composed introductory soundscapes with improvisations by Collins and Levin: these pieces were arranged and realised by David Singleton, reflecting similar work he'd performed for Thrakattak twenty years earlier. On 20 October 2018, a further live album/video was released, Meltdown: Live in Mexico City, recorded during dates in July 2017.
February 20: Decrees enacting the Conventions on the night work of women and of children in industry, drawn up in Washington by the International Labor Conference and signed in Paris on January 24, 1921, by France and Belgium, along with their annexed protocol. August 10: Nationality law. December 6: Decree on the regulations of the École nationale supérieure de céramique in Sèvres, reserved for boys. 1928
Sources: en.wikipedia.org
Cool, dark, and dry conditions are standard, with storage at minus twenty degrees Celsius or below. Desiccant and sealed vials limit moisture uptake. Repeated warming and cooling of the container is generally avoided.
There is no single agreed limit, and laboratory practice varies widely. Refrigeration slows degradation, and freezing aliquots is often described for longer holding. Any visible cloudiness or precipitate indicates the solution should be discarded.
Mass spectrometry provides the most direct confirmation through molecular mass. Reversed-phase chromatography supports purity assessment, and peptide mapping or amino acid analysis can corroborate sequence. No single method establishes both purity and identity on its own.
The mass difference from the linker is large enough for routine detection by mass spectrometry. The unconjugated form gives a single sharp signal at its expected weight. Material that has already reacted with albumin shows a much higher mass and a broadened chromatographic peak.